Loading...
Statistics
Advertisement

Rentaharley.info

Advertisement
Conversion Technology Metas Server
Rentaharley.info is hosted in Germany / Höst . Rentaharley.info uses HTTPS protocol. Number of used technologies: 1. First technologies: Html, Number of used javascripts: 0. Number of used analytics tools: 0. Its server type is: Apache.

Technologies in use by Rentaharley.info

Technology

Number of occurences: 1
  • Html

Advertisement

Server Type

  • Apache

Conversion rate optimization
visitors Clickable call number Not founded!
visitors Conversion form (contact form, subcriber) Not founded!
visitors Clickable email Not founded!
visitors CTA (call to action) button Not founded!
visitors List Not founded!
visitors Image Not founded!
visitors Enhancement Not founded!
visitors Responsive website Not founded!
visitors Facebook sharing Not founded!
visitors Google+ sharing Not founded!
visitors Twitter sharing Not founded!
visitors Linkedin sharing Not founded!
visitors Blog on the webiste Not founded!

HTTPS (SSL) - Rentaharley.info

SSL certificate

    • name: /C=DE/ST=Bayern/L=Forchheim/O=XODOX GmbH/CN=*.xodox.de
    • subject:
      • C: DE
      • ST: Bayern
      • L: Forchheim
      • O: XODOX GmbH
      • CN: *.xodox.de
    • hash: 39a1086e
    • issuer:
      • C: US
      • O: thawte, Inc.
      • CN: thawte SSL CA - G2
    • version: 2
    • serialNumber: 46647749658172575352816090369235608212
    • validFrom: 150511000000Z
    • validTo: 170510235959Z
    • validFrom_time_t: 1431302400
    • validTo_time_t: 1494460799
    • extensions:
      • subjectAltName: DNS:*.xodox.de, DNS:xodox.de
      • basicConstraints: CA:FALSE
      • certificatePolicies: Policy: 2.23.140.1.2.2 CPS: https://www.thawte.com/cps User Notice: Explicit Text: https://www.thawte.com/repository
      • keyUsage: Digital Signature, Key Encipherment
      • authorityKeyIdentifier: keyid:C2:4F:48:57:FC:D1:4F:9A:C0:5D:38:7D:0E:05:DB:D9:2E:B5:52:60
      • crlDistributionPoints: Full Name: URI:http://tj.symcb.com/tj.crl
      • extendedKeyUsage: TLS Web Server Authentication, TLS Web Client Authentication
      • authorityInfoAccess: OCSP - URI:http://tj.symcd.com CA Issuers - URI:http://tj.symcb.com/tj.crt

Meta - Rentaharley.info

Number of occurences: 1
  • Name:
    Content: 0;URL=/cgi-sys/defaultwebpage.cgi

Server / Hosting

  • IP: 188.138.107.178
  • Latitude: 51.65
  • Longitude: 6.18
  • Country: Germany
  • City: Höst

Rname

  • ns2.issociate.de
  • ns3.issociate.de
  • ns4.issociate.de
  • ns1.issociate.de
  • rentaharley.info

Target

  • technik.issociate.net

HTTP Header Response

HTTP/1.1 200 OK Date: Tue, 09 Aug 2016 01:29:49 GMT Server: Apache Last-Modified: Wed, 16 Sep 2015 12:48:04 GMT Accept-Ranges: bytes Content-Length: 111 Strict-Transport-Security: “max-age=31536000″ Content-Type: text/html X-Cache: MISS from s_mf18 X-Cache-Lookup: MISS from s_mf18:80 Via: 1.1 s_mf18 (squid/3.5.9) Connection: keep-alive

DNS

host: rentaharley.info
  1. class: IN
  2. ttl: 86400
  3. type: A
  4. ip: 188.138.107.178
host: rentaharley.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns2.issociate.de
host: rentaharley.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns3.issociate.de
host: rentaharley.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns4.issociate.de
host: rentaharley.info
  1. class: IN
  2. ttl: 86400
  3. type: NS
  4. target: ns1.issociate.de
host: rentaharley.info
  1. class: IN
  2. ttl: 86400
  3. type: SOA
  4. mname: ns1.issociate.de
  5. rname: technik.issociate.net
  6. serial: 2014120300
  7. refresh: 86400
  8. retry: 7200
  9. expire: 3600000
  10. minimum-ttl: 86400
host: rentaharley.info
  1. class: IN
  2. ttl: 14400
  3. type: MX
  4. pri: 0
  5. target: rentaharley.info

Common Typos/Mistakes

This list shows You some spelling mistakes at internet search for this domain.

www.entaharley.info, www.rientaharley.info, www.ientaharley.info, www.roentaharley.info, www.oentaharley.info, www.rlentaharley.info, www.lentaharley.info, www.rlentaharley.info, www.lentaharley.info, www.r.entaharley.info, www..entaharley.info, www.rntaharley.info, www.rexntaharley.info, www.rxntaharley.info, www.resntaharley.info, www.rsntaharley.info, www.rewntaharley.info, www.rwntaharley.info, www.rerntaharley.info, www.rrntaharley.info, www.refntaharley.info, www.rfntaharley.info, www.revntaharley.info, www.rvntaharley.info, www.recntaharley.info, www.rcntaharley.info, www.reqntaharley.info, www.rqntaharley.info, www.reantaharley.info, www.rantaharley.info, www.reyntaharley.info, www.ryntaharley.info, www.retaharley.info, www.renntaharley.info, www.rentaharley.info, www.renhtaharley.info, www.rehtaharley.info, www.renjtaharley.info, www.rejtaharley.info, www.renktaharley.info, www.rektaharley.info, www.renltaharley.info, www.reltaharley.info, www.ren taharley.info, www.re taharley.info, www.renaharley.info, www.rentqaharley.info, www.renqaharley.info, www.rentaaharley.info, www.renaaharley.info, www.rent aharley.info, www.ren aharley.info, www.rentwaharley.info, www.renwaharley.info, www.renteaharley.info, www.reneaharley.info, www.rentzaharley.info, www.renzaharley.info, www.rentxaharley.info, www.renxaharley.info, www.rentcaharley.info, www.rencaharley.info, www.rentharley.info, www.rentaoharley.info, www.rentoharley.info, www.rentapharley.info, www.rentpharley.info, www.renta9harley.info, www.rent9harley.info, www.rentaharley.info, www.rentharley.info, www.rentaiharley.info, www.rentiharley.info, www.rentauharley.info, www.rentuharley.info, www.rentaarley.info, www.rentahearley.info, www.rentaearley.info, www.rentahdarley.info, www.rentadarley.info, www.rentahcarley.info, www.rentacarley.info, www.rentahuarley.info, www.rentauarley.info, www.rentahjarley.info, www.rentajarley.info, www.rentaharley.info, www.rentaarley.info, www.rentahbarley.info, www.rentabarley.info, www.rentahgarley.info, www.rentagarley.info, www.rentahrley.info, www.rentahaorley.info, www.rentahorley.info, www.rentahaprley.info, www.rentahprley.info, www.rentaha9rley.info, www.rentah9rley.info, www.rentaharley.info, www.rentahrley.info, www.rentahairley.info, www.rentahirley.info, www.rentahaurley.info, www.rentahurley.info, www.rentahaley.info, www.rentahariley.info, www.rentahailey.info, www.rentaharoley.info, www.rentahaoley.info, www.rentaharlley.info, www.rentahalley.info, www.rentaharlley.info, www.rentahalley.info, www.rentahar.ley.info, www.rentaha.ley.info, www.rentaharey.info, www.rentaharluey.info, www.rentaharuey.info, www.rentaharl8ey.info, www.rentahar8ey.info, www.rentaharl9ey.info, www.rentahar9ey.info, www.rentaharljey.info, www.rentaharjey.info, www.rentaharl0ey.info, www.rentahar0ey.info, www.rentaharlmey.info, www.rentaharmey.info, www.rentaharlpey.info, www.rentaharpey.info, www.rentaharloey.info, www.rentaharoey.info, www.rentaharly.info, www.rentaharlexy.info, www.rentaharlxy.info, www.rentaharlesy.info, www.rentaharlsy.info, www.rentaharlewy.info, www.rentaharlwy.info, www.rentaharlery.info, www.rentaharlry.info, www.rentaharlefy.info, www.rentaharlfy.info, www.rentaharlevy.info, www.rentaharlvy.info, www.rentaharlecy.info, www.rentaharlcy.info, www.rentaharleqy.info, www.rentaharlqy.info, www.rentaharleay.info, www.rentaharlay.info, www.rentaharleyy.info, www.rentaharlyy.info, www.rentaharle.info, www.rentaharleyz.info, www.rentaharlez.info, www.rentaharleya.info, www.rentaharlea.info, www.rentaharleys.info, www.rentaharles.info, www.rentaharleyd.info, www.rentaharled.info, www.rentaharley.info, www.rentaharle.info, www.rentaharleyc.info, www.rentaharlec.info, www.rentaharley .info, www.rentaharle .info,

Other websites we recently analyzed

  1. Brandywine Realty - Dulles Toll Road Office Properties
    Brandywine Realty Trust (NYSE: BDN) is one of the largest, full-service, integrated real estate companies in the nation. Organized as a real estate investment trust (REIT), Brandywine owns, leases and manages an urban, town center and suburban office portfolio. We proudly serve theDulles Corner and Herndon markets from our regional office in Falls Church
    Woodbury (United States) - 64.206.83.69
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript, Google Analytics, Facebook Box, Google +1 Button, Linkedin Share button, Share This Social Media Buttons, Twitter Button
    Number of Javascript: 11
    Number of meta tags: 9
  2. mamadietz.net
    United States - 208.91.197.27
    Server software: Apache
    Technology: Html
    Number of meta tags: 2
  3. News Perspective Publishing
    San Jose (United States) - 198.38.82.168
    Server software: - Web acceleration by http://www.unixy.net/varnish
    Technology: CSS, Html, Html5, Iframe, Javascript, jQuery, Php, Pingback
    Number of Javascript: 5
    Number of meta tags: 2
  4. weddingplanningrealitycheck.info
    Scottsdale (United States) - 50.63.202.52
    Server software: squid/3.5.12
    Technology: Html, Html5, Iframe
  5. Скрап-маньяки. Скрапбукинг. Украина. Мой любимый интернет-магазин для скрапбукинга и тильд
    Ищете скрапбукинг и тильды в Украине? Вам сюда! Это интернет-магазин Скрапманьяки. В нем потрясающий выбор товаров для скрапбукинга и тильд, он поднимает настроение и дарит вдохновение заниматься любимым хобби! Бесплатная доставка по Украине от 450 грн :) Заходите, я вас жду! Ваш Скрапманьяк.
    West Chester (United States) - 162.248.50.46
    Server software: Apache
    Technology: Carousel, CSS, Html, Html5, Javascript, jQuery Cookie, jQuery Hover Intent, jQuery UI, Php
    Number of Javascript: 9
    Number of meta tags: 2
  6. Home - SpudPress
    Milano (Italy) - 149.154.157.190
    G Analytics ID: UA-36045075-10
    Server software: nginx
    Technology: BootstrapCDN, CloudFlare, Maxcdn, CSS, Font Awesome, Html, Javascript, Php, Google Analytics, Wordpress, Twitter Button
    Number of Javascript: 5
    Number of meta tags: 13
  7. wallclimbers.info
    Germany - 217.160.231.221
    Server software: Apache
    Technology: Html
    Number of meta tags: 1
  8. »ä½¿è¯–
    Cheyenne (United States) - 23.224.80.104
    Server software: Microsoft-IIS/7.5
    Technology: CSS, Html, Javascript
    Number of Javascript: 2
    Number of meta tags: 9
  9. Nilzzon
    Norway - 91.207.158.157
    Server software: nginx
    Technology: Html, Php
    Number of Javascript: 1
    Number of meta tags: 4
  10. Amrita Yoga Magazine | by Yoga Alliance Professionals
    United Kingdom - 212.67.220.87
    G Analytics ID: UA-75003137-1
    Server software: Apache/2.2.22
    Technology: CSS, Flexslider, Font Awesome, Google Font API, Html, Html5, Javascript, jQuery, Lightbox, Php, Pingback, Revslider, Google Analytics, Wordpress, Share This Social Media Buttons
    Number of Javascript: 16
    Number of meta tags: 3

Check Other Websites